Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MAP3K15 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP152971

 View more versions of this product

Catalog No. NBP152971


Add to cart

Description

Description

MAP3K15 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

MAP3K15
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
MAP3K15
Synthetic peptides corresponding to MAP3K15(mitogen-activated protein kinase kinase kinase 15) The peptide sequence was selected from the middle region of MAP3K15. Peptide sequence TLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKT.
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Human: 100%.
Human
Western Blot
Western Blot 1:100-1:2000
Q6ZN16-3
Apoptosis signal-regulating kinase 3, ASK3MEKK 15, bA723P2.3, EC 2.7.11, EC 2.7.11.25, FLJ16518, MAPK/ERK kinase kinase 15, MEK kinase 15, mitogen-activated protein kinase kinase kinase 15
Rabbit
IgG
100 ul
Protein Kinase
Primary
389840
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit