MAP4K2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158852

Catalog No. NBP158852

Description

MAP4K2 Polyclonal specifically detects MAP4K2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MAP4K2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: B lymphocyte serine/threonine protein kinase, B lymphocyte serine/threonine-protein kinase, BL44, EC 2.7.11, EC 2.7.11.1, GC kinase, GCKMEK kinase kinase 2, Germinal center kinase, germinal centre kinase (GC kinase), MAPK/ERK kinase kinase kinase 2, mitogen-activated protein kinase kinase kinase kinase 2, Rab8 interacting protein, Rab8-interacting protein, RAB8IPMEKKK 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 91 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 5871
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q12851
• Gene Symbols: MAP4K2
• Immunogen: Synthetic peptides corresponding to MAP4K2(mitogen-activated protein kinase kinase kinase kinase 2) The peptide sequence was selected from the N terminal of MAP4K2. Peptide sequence HLHPMRALMLMSKSSFQPPKLRDKTRWTQNFHHFLKLALTKNPKKRPTAE.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Canine: 92%; Pig: 92%; Guinea pig: 84%; Zebrafish: 83%.
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG