Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MARCH8. Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309974100UL
Description
44263 Polyclonal specifically detects 44263 in Human samples. It is validated for Western Blot.Specifications
MARCH8. | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Cellular modulator of immune recognition, EC 6.3.2, EC 6.3.2.-, MARCH-VIIIcellular modulator of immune recognition, membrane-associated ring finger (C3HC4) 8, Membrane-associated RING finger protein 8, Membrane-associated RING-CH protein VIII, MIR, RING finger protein 178 | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human MARH8. Peptide sequence MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNIS | |
100 μg | |
Zinc Finger | |
220972 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction