Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MARCH8. Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen MARCH8.
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB124850
View Documents
Novus Biologicals
NBP30997425UL
25 μg
Each for $106.19
Add to cart
 
NB124849
View Documents
Novus Biologicals
NBP309974100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

MARCH8. Polyclonal antibody specifically detects MARCH8. in Human samples. It is validated for Western Blot
Specifications

Specifications

MARCH8.
Western Blot
Purified
RUO
Human
Cellular modulator of immune recognition, EC 6.3.2, EC 6.3.2.-, MARCH-VIIIcellular modulator of immune recognition, membrane-associated ring finger (C3HC4) 8, Membrane-associated RING finger protein 8, Membrane-associated RING-CH protein VIII, MIR, RING finger protein 178
The immunogen is a synthetic peptide directed towards the N-terminal region of Human MARH8. Peptide sequence MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNIS
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Zinc Finger
PBS buffer, 2% sucrose
220972
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit