Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MARK4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$337.75 - $627.50
Specifications
Antigen | MARK4 |
---|---|
Dilution | Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
MARK4 Polyclonal specifically detects MARK4 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
MARK4 | |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
EC 2.7.11, EC 2.7.11.1, FLJ12177, FLJ90097, KIAA1860MARK4L, MAP/microtubule affinity-regulating kinase 4, MAP/microtubule affinity-regulating kinase like 1, MAP/microtubule affinity-regulating kinase-like 1, MARK4 serine/threonine protein kinase, MARKL1L, MARKL1MARK4S, Nbla00650 | |
MARK4 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
Polyclonal | |
Rabbit | |
Apoptosis | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
57787 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:PSDTTNGTSSSKGTSHSKGQRSSSSTYHRQRRHSDFCGPSPAPLHPKRSPTSTGEAELKEERLPGRKASCSTAGSGSR | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title