Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MBD4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | MBD4 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB124963
|
Novus Biologicals
NBP310031100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
MBD4 Polyclonal specifically detects MBD4 in Human samples. It is validated for Western Blot.Specifications
MBD4 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Base Excision Repair, Chromatin Research, DNA Repair, Epigenetics | |
PBS buffer, 2% sucrose | |
8930 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Human | |
EC 3.2.2.-, G/T mismatch glycosylase, G/U mismatch glycosylase, MED1G/5-fluorouracil mismatch glycosylase with biphasic kinetics, methyl-CpG binding domain protein 4, methyl-CpG-binding domain protein 43,N(4)-ethenocytosine glycosylase, Methyl-CpG-binding endonuclease 1, Methyl-CpG-binding protein MBD4, Mismatch-specific DNA N-glycosylase, putative methyl-CpG binding protein | |
The immunogen is a synthetic peptide directed towards the middle region of human MBD4 (NP_001263199.1). Peptide sequence TSLKPEDFDFTVLSKRGIKSRYKDCSMAALTSHLQNQSNNSNWNLRTRSK | |
Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title