Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MBOAT1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Specifications
| Antigen | MBOAT1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155258
|
Novus Biologicals
NBP155258 |
100 μL |
Each of 1 for $436.00
|
N/A | |||||
Description
MBOAT1 Polyclonal specifically detects MBOAT1 in Human samples. It is validated for Western Blot.Specifications
| MBOAT1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| dJ434O11.1, EC 2.3.1.-, EC 2.3.1.n6,1-acylglycerophosphoserine O-acyltransferase, LPEAT1, LPLAT 1, LPSAT, lysophosphatidylethanolamine acyltransferase 1, Lysophosphatidylserine acyltransferase, lysophospholipid acyltransferase 1, Lyso-PS acyltransferase, membrane bound O-acyltransferase domain containing 1, Membrane-bound O-acyltransferase domain-containing protein 1, MGC44669, OACT1, O-acyltransferase (membrane bound) domain containing 1, O-acyltransferase domain-containing protein 1 | |
| MBOAT1 | |
| IgG | |
| Affinity Purified | |
| 56 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q6ZNC8 | |
| 154141 | |
| Synthetic peptides corresponding to MBOAT1(membrane bound O-acyltransferase domain containing 1) The peptide sequence was selected from the N terminal of MBOAT1. Peptide sequence AAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFR. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title