MBP Mouse anti-Human, Mouse, Rat, Porcine, Bovine, Equine, Clone: 7D2, Novus Biologicals™

Mouse Monoclonal Antibody has been used in 2 publications

Supplier:  Novus Biologicals NBP1052040.025ML

Catalog No. NB018357

Description

MBP Monoclonal specifically detects MBP in Human, Mouse, Rat, Porcine, Bovine, Equine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: MBP
• Classification: Monoclonal
• Concentration: 1 mg/ml
• Dilution: Western Blot 1:5000-1:10000, Immunohistochemistry 1:1000, Immunocytochemistry/Immunofluorescence 1:1000
• Gene Alias: MGC99675, Myelin A1 protein, myelin basic protein, Myelin membrane encephalitogenic protein
• Host Species: Mouse
• Molecular Weight of Antigen: 18.5/21.5 kDa
• Quantity: 0.025 mL
• Research Discipline: Neuroscience, Neurotransmission, Oligodendrocyte Cell Markers, Stem Cell Markers
• Gene ID (Entrez): 4155
• Target Species: Rat, Human, Mouse, Equine, Porcine, Bovine
• Form: Ascites

• Applications: Western Blot, Immunofluorescence, Immunocytochemistry, Immunohistochemistry
• Clone: 7D2
• Conjugate: Unconjugated
• Formulation: 50% PBS, 50% Glycerol with 5mM Sodium Azide
• Gene Symbols: MBP
• Immunogen: Purified myelin basic protein isolated from bovine brain, epitope maps to the peptide AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG, amino acids 145-184 of the human 21.5kDa sequence.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: The MBP Antibody (7D2) antibody binds only the 21.5kDa and 18.5kDa rat MBP isotypes, but all four isotypes of human and bovine MBP.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG1

For Research Use Only