Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MBP Antibody (7D2), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 2 publications
Supplier: Novus Biologicals NBP1052040.025ML
Description
MBP Monoclonal specifically detects MBP in Human, Mouse, Rat, Porcine, Bovine, Equine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence.Specifications
MBP | |
Monoclonal | |
1 mg/ml | |
Western Blot 1:5000-1:10000, Immunohistochemistry 1:1000, Immunocytochemistry/Immunofluorescence 1:1000 | |
MGC99675, Myelin A1 protein, myelin basic protein, Myelin membrane encephalitogenic protein | |
Mouse | |
18.5/21.5 kDa | |
0.025 mL | |
Neuroscience, Neurotransmission, Oligodendrocyte Cell Markers, Stem Cell Markers | |
4155 | |
Rat, Human, Mouse, Equine, Porcine, Bovine | |
Ascites |
Western Blot, Immunofluorescence, Immunocytochemistry, Immunohistochemistry | |
7D2 | |
Unconjugated | |
50% PBS, 50% Glycerol with 5mM Sodium Azide | |
MBP | |
Purified myelin basic protein isolated from bovine brain, epitope maps to the peptide AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG, amino acids 145-184 of the human 21.5kDa sequence. | |
Affinity purified | |
RUO | |
Primary | |
The MBP Antibody (7D2) antibody binds only the 21.5kDa and 18.5kDa rat MBP isotypes, but all four isotypes of human and bovine MBP. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG1 |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction