Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MBP Mouse anti-Human, Mouse, Rat, Porcine, Bovine, Equine, Clone: 7D2, Novus Biologicals™

Mouse Monoclonal Antibody has been used in 2 publications

$176.85 - $436.00

Specifications

Antigen MBP
Clone 7D2
Concentration 1 mg/ml
Dilution Western Blot 1:5000-1:10000, Immunohistochemistry 1:1000, Immunocytochemistry/Immunofluorescence 1:1000
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP105204
View Documents
Novus Biologicals
NBP105204
0.1 mL
Each for $436.00
Add to cart
 
NB018357
View Documents
Novus Biologicals
NBP1052040.025ML
0.025 mL
Each for $176.85
Add to cart
 
Description

Description

MBP Monoclonal specifically detects MBP in Human, Mouse, Rat, Porcine, Bovine, Equine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence.
Specifications

Specifications

MBP
1 mg/ml
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
Unconjugated
Mouse
Neuroscience, Neurotransmission, Oligodendrocyte Cell Markers, Stem Cell Markers
MGC99675, Myelin A1 protein, myelin basic protein, Myelin membrane encephalitogenic protein
MBP
IgG1
Affinity purified
The MBP Antibody (7D2) antibody binds only the 21.5kDa and 18.5kDa rat MBP isotypes, but all four isotypes of human and bovine MBP.
7D2
Western Blot 1:5000-1:10000, Immunohistochemistry 1:1000, Immunocytochemistry/Immunofluorescence 1:1000
Monoclonal
Ascites
RUO
Human, Mouse, Rat, Porcine, Bovine, Equine
4155
Purified myelin basic protein isolated from bovine brain, epitope maps to the peptide AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG, amino acids 145-184 of the human 21.5kDa sequence.
Primary
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
18.5/21.5 kDa
SDS
Product Certifications

For Research Use Only

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit