MBP Mouse anti-Human, Mouse, Rat, Porcine, Bovine, Equine, Clone: 7D2, Novus Biologicals™

Mouse Monoclonal Antibody has been used in 2 publications

Catalog Number	Mfr. No.	Quantity
NBP105204	Novus Biologicals NBP105204	0.1 mL
NB018357	Novus Biologicals NBP1052040.025ML	0.025 mL

Description

MBP Monoclonal specifically detects MBP in Human, Mouse, Rat, Porcine, Bovine, Equine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: MBP
• Concentration: 1 mg/ml
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Host Species: Mouse
• Research Discipline: Neuroscience, Neurotransmission, Oligodendrocyte Cell Markers, Stem Cell Markers
• Gene Alias: MGC99675, Myelin A1 protein, myelin basic protein, Myelin membrane encephalitogenic protein
• Gene Symbols: MBP
• Isotype: IgG1
• Purification Method: Affinity purified
• Test Specificity: The MBP Antibody (7D2) antibody binds only the 21.5kDa and 18.5kDa rat MBP isotypes, but all four isotypes of human and bovine MBP.

• Clone: 7D2
• Dilution: Western Blot 1:5000-1:10000, Immunohistochemistry 1:1000, Immunocytochemistry/Immunofluorescence 1:1000
• Classification: Monoclonal
• Form: Ascites
• Regulatory Status: RUO
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Equine
• Gene ID (Entrez): 4155
• Immunogen: Purified myelin basic protein isolated from bovine brain, epitope maps to the peptide AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG, amino acids 145-184 of the human 21.5kDa sequence.
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Molecular Weight of Antigen: 18.5/21.5 kDa

For Research Use Only