Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MCEE Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179808
Description
MCEE Polyclonal specifically detects MCEE in Human samples. It is validated for Western Blot.Specifications
MCEE | |
Polyclonal | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DL-methylmalonyl-CoA racemase, EC 5.1.99.1, GLOD2, glyoxalase domain containing 2, methylmalonyl CoA epimerase, methylmalonyl-CoA epimerase, mitochondrial | |
Rabbit | |
19 kDa | |
100 μL | |
Proteases & Other Enzymes | |
84693 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
1.0 mg/mL | |
Western Blot 1.0 ug/ml | |
Q96PE7 | |
MCEE | |
Synthetic peptide directed towards the C terminal of human MCEEThe immunogen for this antibody is MCEE (NP_115990). Peptide sequence DSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAH. | |
Affinity Purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Guinea pig: 79% Chicken: 85%. | |
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title