Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MCEE Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17980820UL

 View more versions of this product

Catalog No. NBP17980820


Add to cart

Description

Description

MCEE Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

MCEE
1.0 mg/mL
Western Blot 0.2-1 ug/ml
Q96PE7
DL-methylmalonyl-CoA racemase, EC 5.1.99.1, GLOD2, glyoxalase domain containing 2, methylmalonyl CoA epimerase, methylmalonyl-CoA epimerase, mitochondrial
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
84693
Western Blot
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
MCEE
Synthetic peptide directed towards the C terminal of human MCEEThe immunogen for this antibody is MCEE (NP_115990). Peptide sequence DSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAH.
19 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit