Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MCEE Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen MCEE
Concentration 1.0 mg/mL
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP179808
View Documents
Novus Biologicals
NBP179808
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

MCEE Polyclonal specifically detects MCEE in Human samples. It is validated for Western Blot.
Specifications

Specifications

MCEE
Western Blot
Unconjugated
RUO
Q96PE7
84693
Synthetic peptide directed towards the C terminal of human MCEEThe immunogen for this antibody is MCEE (NP_115990). Peptide sequence DSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAH.
Primary
Store at -20C. Avoid freeze-thaw cycles.
1.0 mg/mL
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
DL-methylmalonyl-CoA racemase, EC 5.1.99.1, GLOD2, glyoxalase domain containing 2, methylmalonyl CoA epimerase, methylmalonyl-CoA epimerase, mitochondrial
MCEE
IgG
Affinity Purified
19 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit