Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MCEE Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | MCEE |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179808
|
Novus Biologicals
NBP179808 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
MCEE Polyclonal specifically detects MCEE in Human samples. It is validated for Western Blot.Specifications
| MCEE | |
| Polyclonal | |
| Rabbit | |
| Q96PE7 | |
| 84693 | |
| Synthetic peptide directed towards the C terminal of human MCEEThe immunogen for this antibody is MCEE (NP_115990). Peptide sequence DSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAH. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DL-methylmalonyl-CoA racemase, EC 5.1.99.1, GLOD2, glyoxalase domain containing 2, methylmalonyl CoA epimerase, methylmalonyl-CoA epimerase, mitochondrial | |
| MCEE | |
| IgG | |
| 19 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title