Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MCM10 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | MCM10 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP18239520
|
Novus Biologicals
NBP18239520UL |
20 μL |
Each for $152.22
|
|
NBP182395
|
Novus Biologicals
NBP182395 |
100 μL |
Each for $436.00
|
|
Description
MCM10 Polyclonal specifically detects MCM10 in Mouse samples. It is validated for Western Blot.Specifications
| MCM10 | |
| Polyclonal | |
| Rabbit | |
| NP_081566 | |
| 55388 | |
| Synthetic peptide towards Mcm10. Peptide sequence DEFDELFDADGDGESYTEEAGSGEEGKTGNQEERLATLFGDVEDLTDDEV. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CNA43homolog of yeast MCM10, DNA43, hsMCM10, MCM10 minichromosome maintenance deficient 10, MCM10 minichromosome maintenance deficient 10 (S. cerevisiae), MGC126776, minichromosome maintenance complex component 10, PRO2249, protein MCM10 homolog | |
| MCM10 | |
| IgG | |
| Affinity Purified | |
| 98 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title