Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MDH1B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | MDH1B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15644620
|
Novus Biologicals
NBP15644620UL |
20 μL |
Each for $152.22
|
|
NBP156446
|
Novus Biologicals
NBP156446 |
100 μL |
Each for $436.00
|
|
Description
MDH1B Polyclonal specifically detects MDH1B in Human samples. It is validated for Western Blot.Specifications
| MDH1B | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EC 1.1.1.-, FLJ25341, malate dehydrogenase 1B, NAD (soluble), putative malate dehydrogenase 1B, RP11-95H11 | |
| MDH1B | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Human | |
| Q5I0G3 | |
| 130752 | |
| Synthetic peptides corresponding to MDH1B (malate dehydrogenase 1B, NAD (soluble)) The peptide sequence was selected from the middle region of MDH1B)(50ug). Peptide sequence YQSGHKDLVPDEEKNLAMSDAAEFPNQIPQTTFEKPQSLEFLNEFEGKTV. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title