Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MDP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | MDP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156573
|
Novus Biologicals
NBP156573 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
MDP1 Polyclonal specifically detects MDP1 in Human samples. It is validated for Western Blot.Specifications
| MDP1 | |
| Polyclonal | |
| Rabbit | |
| Protein Phosphatase | |
| Q86V88 | |
| 145553 | |
| Synthetic peptides corresponding to MDP-1 The peptide sequence was selected from the N terminal of MDP-1. Peptide sequence MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EC 3.1.3.-, EC 3.1.3.48, FN6Pase, fructosamine-6-phosphatase, magnesium-dependent phosphatase 1, MDP-1, MGC5987, S, SFTB3, SFTPB | |
| MDP1 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title