Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ME2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154765

 View more versions of this product

Catalog No. NBP154765

Add to cart



ME2 Polyclonal antibody specifically detects ME2 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot.


PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
Synthetic peptides corresponding to ME2(malic enzyme 2, NAD(+)-dependent, mitochondrial) The peptide sequence was selected from the N terminal of ME2. Peptide sequence MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMG.
65 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:100-1:2000
EC 1.1.1, EC, malate dehydrogenase, Malic enzyme 2, malic enzyme 2, NAD(+)-dependent, mitochondrial, NAD-dependent malic enzyme, mitochondrial, NAD-ME, ODS1, pyruvic-malic carboxylase
Immunogen affinity purified
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit