Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ME2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ME2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154765
|
Novus Biologicals
NBP154765 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ME2 Polyclonal specifically detects ME2 in Human samples. It is validated for Western Blot.Specifications
| ME2 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EC 1.1.1, EC 1.1.1.38, malate dehydrogenase, Malic enzyme 2, malic enzyme 2, NAD(+)-dependent, mitochondrial, NAD-dependent malic enzyme, mitochondrial, NAD-ME, ODS1, pyruvic-malic carboxylase | |
| ME2 | |
| IgG | |
| Affinity Purified | |
| 65 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P23368 | |
| 4200 | |
| Synthetic peptides corresponding to ME2(malic enzyme 2, NAD(+)-dependent, mitochondrial) The peptide sequence was selected from the N terminal of ME2. Peptide sequence MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMG. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title