Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MED27 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | MED27 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB125515
|
Novus Biologicals
NBP310307100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
MED27 Polyclonal specifically detects MED27 in Human samples. It is validated for Western Blot.Specifications
| MED27 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| cofactor required for Sp1 transcriptional activation, subunit 8, 34kDa, CRSP34CRSP complex subunit 8, CRSP8CRAP34, mediator complex subunit 27Transcriptional coactivator CRSP34, mediator of RNA polymerase II transcription subunit 27, MGC11274, P37 TRAP/SMCC/PC2 subunit, subunit 8 (34kD), TRAP37 | |
| The immunogen is a synthetic peptide directed towards the middle region of human MED27 (NP_004260). Peptide sequence LSRPNGTSAMLLVTLGKVLKVIVVMRSLFIDRTIVKGYNENVYTEDGKLD | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 9442 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title