Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MED30 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP258363
Description
MED30 Polyclonal specifically detects MED30 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
MED30 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
mediator complex subunit 30TRAP/Mediator complex component TRAP25, mediator of RNA polymerase II transcription subunit 30, putative mediator of RNA polymerase II transcription subunit 30, THRAP6MGC9890, thyroid hormone receptor associated protein 6, Thyroid hormone receptor-associated protein 6, Thyroid hormone receptor-associated protein complex 25 kDa component, Trap25, TRAP25MED30S | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
MED30 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTY | |
100 μL | |
Signal Transduction | |
90390 | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction