Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MEKK1 Mouse anti-Human, Clone: 2F6, Azide and BSA Free, Novus Biologicals™

Mouse Monoclonal Antibody

$574.00

Specifications

Antigen MEKK1
Clone 2F6
Concentration 1.0 mg/mL
Dilution Western Blot : 0.5 - 1.0 ug/ml, Flow Cytometry : 0.5 - 1 ug/million cells in 0.1 ml, Immunohistochemistry-Paraffin : 0.5 - 1.0 ug/ml, Immunofluorescence : 1 - 2 ug/ml, CyTOF-ready
Applications Western Blot, Flow Cytometry, Immunohistochemistry (Paraffin), Immunofluorescence, CyTOF
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP247810A
View Documents
Novus Biologicals
NBP2478100.1MG
0.1 mg
Each for $574.00
Add to cart
 
NBP247810B
View Documents
Novus Biologicals
NBP2478100.2MG
0.2 mg This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

MEKK1 Monoclonal specifically detects MEKK1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

MEKK1
1.0 mg/mL
Western Blot, Flow Cytometry, Immunohistochemistry (Paraffin), Immunofluorescence, CyTOF
Unconjugated
Mouse
Angiogenesis, Breast Cancer, Cancer, Lipid and Metabolism, MAP Kinase Signaling, mTOR Pathway, Protein Kinase, Signal Transduction, Tyrosine Kinases
PBS with No Preservative
4214
Partial recombinant MAP3K1 (aa1211-1310) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)
Primary
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
2F6
Western Blot : 0.5 - 1.0 ug/ml, Flow Cytometry : 0.5 - 1 ug/million cells in 0.1 ml, Immunohistochemistry-Paraffin : 0.5 - 1.0 ug/ml, Immunofluorescence : 1 - 2 ug/ml, CyTOF-ready
Monoclonal
Purified
RUO
Human
MAPK/ERK kinase kinase 1, MAPKKK1MAP/ERK kinase kinase 1, MEK kinase 1, MEKK1EC 2.7.11.25, MEKKMEKK 1, mitogen-activated protein kinase kinase kinase 1
MAP3K1
IgG2a κ
Protein A or G purified
Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NF B pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit