Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Melanocortin-3 R/MC3R Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | Melanocortin-3 R/MC3R |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB124955
|
Novus Biologicals
NBP310027100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
Melanocortin-3 R/MC3R Polyclonal specifically detects Melanocortin-3 R/MC3R in Human, Mouse samples. It is validated for Western Blot.Specifications
| Melanocortin-3 R/MC3R | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| GPCR | |
| PBS buffer, 2% sucrose | |
| 4159 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| BMIQ9, MC3, MC3-R, melanocortin 3 receptor, melanocortin receptor 3, OB20, Obesity quantitative trait locus, OQTL | |
| The immunogen is a synthetic peptide directed towards the C terminal region of human Melanocortin-3 R/MC3R (NP_063941.3). Peptide sequence PTNPYCICYTAHFNTYLVLIMCNSVIDPLIYAFRSLELRNTFREILCGCN | |
| Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title