Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Melanoma antigen family E1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP19148920UL

 View more versions of this product

Catalog No. NBP19148920

Add to cart



Melanoma antigen family E1 Polyclonal antibody specifically detects Antigen in Mouse samples. It is validated for Western Blotting.


Melanoma antigen family E1
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
Synthetic peptide directed towards the C terminal of human Magee1. Peptide sequence GRECTKVFPDLLNRAARTLNHVYGTELVVLDPRNHSYTLYNRREMEDTEE.
80 kDa
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Western Blot 1:1000
Alpha-dystrobrevin-associated MAGE Protein, DAMAGEMAGE-E1 antigen, HCA1, hepatocellular carcinoma-associated HCA1, Hepatocellular carcinoma-associated protein 1, KIAA1587dystrobrevin-associated MAGE protein, melanoma antigen family E, 1, melanoma-associated antigen E1
Immunogen affinity purified
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit