Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Methionine Aminopeptidase 1/METAP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15308820UL

 View more versions of this product

Catalog No. NBP15308820

Add to cart



Methionine Aminopeptidase 1/METAP1 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.


Methionine Aminopeptidase 1/METAP1
PBS and 2% Sucrose with 0.09% Sodium Azide
DKFZp781C0419, EC, KIAA0094MAP 1, MAP1A, MetAP 1, MetAP1A, methionine aminopeptidase 1, methionyl aminopeptidase 1, Peptidase M 1
Immunogen affinity purified
Western Blot
Western Blot 1:100-1:2000
Affinity Purified
Synthetic peptides corresponding to METAP1(methionyl aminopeptidase 1) The peptide sequence was selected from the N terminal of METAP1. Peptide sequence GDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQ.
30 kDa
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit