Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Methyltransferase like 6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP155179
Description
Methyltransferase like 6 Polyclonal specifically detects Methyltransferase like 6 in Human samples. It is validated for Western Blot.Specifications
Methyltransferase like 6 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
METTL6 | |
Synthetic peptides corresponding to METTL6(methyltransferase like 6) The peptide sequence was selected from the N terminal of METTL6. Peptide sequence QKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTML. | |
Affinity purified | |
RUO | |
Primary | |
Yeast: 86%. | |
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Rabbit, Yeast, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
EC 2.1.1, EC 2.1.1.-, EC 2.1.1.41, methyltransferase like 6, methyltransferase-like protein 6, MGC24132 | |
Rabbit | |
33 kDa | |
100 μL | |
Lipid and Metabolism | |
131965 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction