Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Methyltransferase like 6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP155179

 View more versions of this product

Catalog No. NBP155179


Add to cart

Description

Description

Methyltransferase like 6 Polyclonal antibody specifically detects Methyltransferase like 6 in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Rabbit, Yeast, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

Methyltransferase like 6
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
EC 2.1.1, EC 2.1.1.-, EC 2.1.1.41, methyltransferase like 6, methyltransferase-like protein 6, MGC24132
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Yeast: 86%.
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish
Western Blot
Western Blot 1:100-1:2000
Affinity Purified
METTL6
Synthetic peptides corresponding to METTL6(methyltransferase like 6) The peptide sequence was selected from the N terminal of METTL6. Peptide sequence QKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTML.
33 kDa
100 ul
Lipid and Metabolism
Primary
131965
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit