Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MFAP3L Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | MFAP3L |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP170637
|
Novus Biologicals
NBP170637 |
100 μL |
Each for $436.00
|
|
NBP17063720
|
Novus Biologicals
NBP17063720UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
MFAP3L Polyclonal specifically detects MFAP3L in Human samples. It is validated for Western Blot.Specifications
| MFAP3L | |
| Polyclonal | |
| Purified | |
| RUO | |
| HSD39, HSD-39, microfibrillar-associated protein 3-like, NYD-sp9, testis development protein NYD-SP9 | |
| MFAP3L | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 9848 | |
| Synthetic peptides corresponding to MFAP3L(microfibrillar-associated protein 3-like) The peptide sequence was selected from the N terminal of MFAP3L. Peptide sequence MHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGDMGVYY. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title