Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MFRP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | MFRP |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP159568
|
Novus Biologicals
NBP159568 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
MFRP Polyclonal specifically detects MFRP in Human samples. It is validated for Western Blot.Specifications
MFRP | |
Polyclonal | |
Rabbit | |
Growth and Development, Neuronal Cell Markers, Vision | |
MCOP5, membrane frizzled-related protein, Membrane-type frizzled-related protein, MGC32938, NNO2, RD6 | |
MFRP | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q9BY79 | |
83552 | |
Synthetic peptides corresponding to MFRP(membrane frizzled-related protein) The peptide sequence was selected from the middle region of MFRP. Peptide sequence HAIQLKIEALSIESVASCLFDRLELSPEPEGPLLRVCGRVPPPTLNTNAS. | |
Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title