Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MGAT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP162441
Description
MGAT2 Polyclonal specifically detects MGAT2 in Human samples. It is validated for Western Blot.Specifications
MGAT2 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase, Beta-1,2-N-acetylglucosaminyltransferase II, CDG2A, EC 2.4.1.143, GlcNAc-T II, GLCNACTII, GNT2, GNT-IICDGS2, Mannoside acetylglucosaminyltransferase 2, mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase II, UDP-N-acetylglucosamine:alpha-6-D-mannosidebeta-1,2-N-acetylglucosaminyltransferase II | |
Rabbit | |
51 kDa | |
100 μL | |
metabolism, Proteases & Other Enzymes | |
4247 | |
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q10469 | |
MGAT2 | |
Synthetic peptides corresponding to MGAT2(mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase) The peptide sequence was selected from the middle region of MGAT2. Peptide sequence YAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSF The peptide sequence for this immunogen was taken from within the described region. | |
Affinity purified | |
RUO | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction