Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MGC13138 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | MGC13138 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179709
|
Novus Biologicals
NBP179709 |
100 μL |
Each for $436.00
|
|
NBP17970920
|
Novus Biologicals
NBP17970920UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
MGC13138 Polyclonal specifically detects MGC13138 in Human samples. It is validated for Western Blot.Specifications
| MGC13138 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| MGC13138, zinc finger protein 764 | |
| ZNF764 | |
| IgG | |
| Affinity Purified | |
| 45 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_219363 | |
| 92595 | |
| Synthetic peptide directed towards the N terminal of human ZNF764. Peptide sequence: APPLAPLPPRDPNGAGPEWREPGAVSFADVAVYFCREEWGCLRPAQRALY | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title