Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MIA2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | MIA2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP174078
|
Novus Biologicals
NBP174078 |
100 μL |
Each of 1 for $436.00
|
|
Description
MIA2 Polyclonal specifically detects MIA2 in Human samples. It is validated for Western Blot.Specifications
MIA2 | |
Polyclonal | |
Rabbit | |
Human | |
Q96PC5-2 | |
117153 | |
Synthetic peptides corresponding to the C terminal of MIA2. Immunizing peptide sequence NTKVMIFKSSYSLSDMVSNIELPTRIHEEVYFEPSSSKDSDENSKPSVDT. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ22404, melanoma inhibitory activity 2, melanoma inhibitory activity protein 2 | |
MIA2 | |
IgG | |
Affinity Purified | |
74 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title