Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MIER3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | MIER3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180413
|
Novus Biologicals
NBP180413 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
MIER3 Polyclonal specifically detects MIER3 in Human samples. It is validated for Western Blot.Specifications
| MIER3 | |
| Polyclonal | |
| Rabbit | |
| NP_689835 | |
| 166968 | |
| Synthetic peptide directed towards the middle region of human MIER3. Peptide sequence MNMCSEESERPAKRLKMGIAVPESFMNEVSVNNLGVDFENHTHHITSAKM. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DKFZp686L09111, DKFZp781G1119, DKFZp781I1119, FLJ35954, mesoderm induction early response 1, family member 3, mesoderm induction early response protein 3, mi-er3 | |
| MIER3 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title