Mindin/Spondin-2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159176

Catalog No. NBP159176

Description

Mindin/Spondin-2 Polyclonal specifically detects Mindin/Spondin-2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Mindin/Spondin-2
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9BUD6
• Gene Symbols: SPON2
• Immunogen: Synthetic peptides corresponding to SPON2(spondin 2, extracellular matrix protein) The peptide sequence was selected from the N terminal of SPON2. Peptide sequence CSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMW.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%; Xenopus: 92%; Chicken: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Differentially expressed in cancerous and non-cancerous lung cells 1, DIL-1, DIL1FLJ34460, DKFZp686G21139, FLJ16313, FLJ22401, MINDIN, M-SPONDIN, spondin 2, extracellular matrix protein, spondin-2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10417
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.