Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Mindin/Spondin-2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159176
Description
Mindin/Spondin-2 Polyclonal specifically detects Mindin/Spondin-2 in Human samples. It is validated for Western Blot.Specifications
Mindin/Spondin-2 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
Differentially expressed in cancerous and non-cancerous lung cells 1, DIL-1, DIL1FLJ34460, DKFZp686G21139, FLJ16313, FLJ22401, MINDIN, M-SPONDIN, spondin 2, extracellular matrix protein, spondin-2 | |
Rabbit | |
Affinity purified | |
RUO | |
10417 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q9BUD6 | |
SPON2 | |
Synthetic peptides corresponding to SPON2(spondin 2, extracellular matrix protein) The peptide sequence was selected from the N terminal of SPON2. Peptide sequence CSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMW. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Bovine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%; Xenopus: 92%; Chicken: 92%. | |
Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Zebrafish | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction