Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Mindin/Spondin-2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | Mindin/Spondin-2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159176
|
Novus Biologicals
NBP159176 |
100 μL |
Each for $436.00
|
|
NBP15917620
|
Novus Biologicals
NBP15917620UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
Mindin/Spondin-2 Polyclonal specifically detects Mindin/Spondin-2 in Human samples. It is validated for Western Blot.Specifications
| Mindin/Spondin-2 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Differentially expressed in cancerous and non-cancerous lung cells 1, DIL-1, DIL1FLJ34460, DKFZp686G21139, FLJ16313, FLJ22401, MINDIN, M-SPONDIN, spondin 2, extracellular matrix protein, spondin-2 | |
| SPON2 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9BUD6 | |
| 10417 | |
| Synthetic peptides corresponding to SPON2(spondin 2, extracellular matrix protein) The peptide sequence was selected from the N terminal of SPON2. Peptide sequence CSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMW. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title