Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MIR16 Rabbit anti-Human, Polyclonal, Novus Biologicals
Rabbit Polyclonal Antibody
Manufacturer: Novus Biologicals NBP257760
Description
MIR16 Polyclonal antibody specifically detects MIR16 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
MIR16 | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
EC 3.1.4.44, glycerophosphodiester phosphodiesterase 1, membrane interacting protein of RGS16, Membrane-interacting protein of RGS16, MIR16363E6.2, RGS16-interacting membrane protein | |
Rabbit | |
IgG | |
100 ul | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
Polyclonal | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
Affinity Purified | |
GDE1 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AKNGATGVELDIEFTSDGIPVLMHDNTVDRTTDGTGRLCDLTFEQIRKLNPAANHRLRNDFPDEKIPTLREAVAECLNHNLTIFFDVKGHAHKATEALKKMYMEFPQL | |
Affinity purified | |
RUO | |
Primary | |
51573 | |
Human |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only