MIS18A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP170753

Catalog No. NBP170753

Description

MIS18A Polyclonal specifically detects MIS18A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MIS18A
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: B28, C21orf45, C21orf46, FAPP1-associated protein 1, FASP1, hMis18alpha, MIS18 kinetochore protein homolog A (S. pombe), MIS18alpha, protein Mis18-alpha
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54069
• Target Species: Human, Rat, Bovine, Canine, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: MIS18A
• Immunogen: Synthetic peptides corresponding to Mis18a Antibody (against the N terminal of Mis18a). Peptide sequence MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWAS.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.