Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MKI67 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant human MKI67.

Manufacturer:  Abnova Corporation PAB29307

Catalog No. 89-934-553


Add to cart

Description

Description

This gene encodes a nuclear protein that is associated with and may be necessary for cellular proliferation. Alternatively spliced transcript variants have been described. A related pseudogene exists on chromosome X. [provided by RefSeq]

Sequence: DGPHFPLSLSTCLFGRGIECDIRIQLPVVSKQHCKIEIHEQEAILHNFSSTNPTQVNGSVIDEPVRLKHGDVITIIDRSFRYENESLQSGRKSTEFPRKIREQEPARRVSRSSFSSDPDEKAQDSKAYSKITEGKVSGNPQVHI
Specifications

Specifications

MKI67
Unconjugated
Immunofluorescence (1-4 ug/mL) Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
Liquid
MKI67
Recombinant protein corresponding to amino acids 16-159 of human MKI67.
Antigen affinity purification
RUO
Primary
4288
Immunofluorescence, Immunohistochemistry (PFA fixed)
Rabbit polyclonal antibody raised against recombinant human MKI67.
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
KIA/Ki-67
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit