MLF1 Interacting Protein Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP309384100UL

Catalog No. NB123669

Description

MLF1 Interacting Protein Polyclonal specifically detects MLF1 Interacting Protein in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MLF1 Interacting Protein
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: CENP-50, CENP-U, CENPU50, CENPUMLF1-interacting protein, centromere protein of 50 kDa, centromere protein U, FLJ23468, ICEN24, Interphase centromere complex protein 24, KLIP1CENP50, KSHV latent nuclear antigen interacting protein 1, KSHV latent nuclear antigen-interacting protein 1, MLF1 interacting protein, PBIP1, Polo-box-interacting protein 1
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human MLF1 Interacting Protein (NP_078905.2). Peptide sequence IYADEEEFSKHCGLSLSSTPPGKEAKRSSDTSGNEASEIESVKISAKKPG
• Quantity: 100 μg
• Research Discipline: Phospho Specific
• Gene ID (Entrez): 79682
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified