Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MMADHC Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179585
Description
MMADHC Polyclonal specifically detects MMADHC in Human samples. It is validated for Western Blot.Specifications
| MMADHC | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| NP_056517 | |
| MMADHC | |
| Synthetic peptide directed towards the N terminal of human C2orf25. Peptide sequence GSSGSDESHVAAAPPDICSRTVWPDETMGPFGPQDQRFQLPGNIGFDCHL. | |
| 100 μL | |
| metabolism | |
| 27249 | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| cblD, chromosome 2 open reading frame 25, methylmalonic aciduria (cobalamin deficiency) cblD type, with homocystinuria, mitochondrial, protein C2orf25, mitochondrial | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title