Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MMP-15/MT2-MMP Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310016100UL
Description
MMP-15/MT2-MMP Polyclonal specifically detects MMP-15/MT2-MMP in Human samples. It is validated for Western Blot.Specifications
MMP-15/MT2-MMP | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
EC 3.4.24, EC 3.4.24.-, EC 3.4.24.80, matrix metallopeptidase 15 (membrane-inserted), matrix metalloproteinase 15 (membrane-inserted), Membrane-type matrix metalloproteinase 2, Membrane-type-2 matrix metalloproteinase, MMP-15, MT2-MMPMT2MMP, MTMMP2MT-MMP 2, SMCP-2matrix metalloproteinase-15 | |
The immunogen is a synthetic peptide directed towards the middle region of human MMP-15/MT2-MMP (NP_002419.1). Peptide sequence DDLRGIQQLYGTPDGQPQPTQPLPTVTPRRPGRPDHRPPRPPQPPPPGGK | |
100 μg | |
Extracellular Matrix | |
4324 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction