MMP-19 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15709420UL

Catalog No. NBP15709420

Description

MMP-19 Polyclonal specifically detects MMP-19 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MMP-19
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q99542
• Gene Symbols: MMP19
• Immunogen: Synthetic peptides corresponding to MMP19 (matrix metallopeptidase 19) The peptide sequence was selected from the C terminal of MMP19. Peptide sequence IHFFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGS.
• Quantity: 20 μL
• Research Discipline: Angiogenesis, Cancer, Extracellular Matrix
• Gene ID (Entrez): 4327
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.4.24.-, matrix metallopeptidase 19, matrix metalloproteinase 18, matrix metalloproteinase 19, Matrix metalloproteinase RASI, Matrix metalloproteinase-18, matrix metalloproteinase-19, MMP-18, MMP18MMP-19, RASI, RASI-1
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified