Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MMP20 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16232220UL
Description
MMP20 Polyclonal specifically detects MMP20 in Human samples. It is validated for Western Blot.Specifications
MMP20 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
O60882 | |
MMP20 | |
Synthetic peptides corresponding to MMP20(matrix metallopeptidase 20) The peptide sequence was selected from the middle region of MMP20. Peptide sequence AAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDA. | |
Affinity Purified | |
RUO | |
9313 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
AI2A2, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.22, EC 3.4.24.35, Enamel metalloproteinase, Enamelysin, matrix metallopeptidase 20, matrix metalloproteinase 20 (enamelysin), matrix metalloproteinase-20, MMP-20 | |
Rabbit | |
43 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title