MMP20 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162322

Catalog No. NBP162322

Description

MMP20 Polyclonal specifically detects MMP20 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MMP20
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O60882
• Gene Symbols: MMP20
• Immunogen: Synthetic peptides corresponding to MMP20(matrix metallopeptidase 20) The peptide sequence was selected from the middle region of MMP20. Peptide sequence AAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDA.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9313
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: AI2A2, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.22, EC 3.4.24.35, Enamel metalloproteinase, Enamelysin, matrix metallopeptidase 20, matrix metalloproteinase 20 (enamelysin), matrix metalloproteinase-20, MMP-20
• Host Species: Rabbit
• Molecular Weight of Antigen: 43 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.