MMP23B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP160036

Catalog No. NBP160036

Description

MMP23B Polyclonal specifically detects MMP23B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MMP23B
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O75900
• Gene Symbols: MMP23B
• Immunogen: Synthetic peptides corresponding to MMP23B(matrix metallopeptidase 23B) The peptide sequence was selected from the middle region of MMP23B. Peptide sequence QKILHKKGKVYWYKDQEPLEFSYPGYLALGEAHLSIIANAVNEGTYTCVV.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 8510
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.4.24.-, Femalysin, matrix metallopeptidase 23B, matrix metalloproteinase 22, matrix metalloproteinase 23B, matrix metalloproteinase in the female reproductive tract, Matrix metalloproteinase-21, Matrix metalloproteinase-22, matrix metalloproteinase-23, MIFR, MIFR-1MMP22femalysin, MMP21, MMP-21, MMP-22, MMP-23, MMP23A
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Human: 100%; Chicken: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Zebrafish
• Isotype: IgG