Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MMP23B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen MMP23B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP160036
View Documents
Novus Biologicals
NBP160036
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

MMP23B Polyclonal specifically detects MMP23B in Human samples. It is validated for Western Blot.
Specifications

Specifications

MMP23B
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
EC 3.4.24.-, Femalysin, matrix metallopeptidase 23B, matrix metalloproteinase 22, matrix metalloproteinase 23B, matrix metalloproteinase in the female reproductive tract, Matrix metalloproteinase-21, Matrix metalloproteinase-22, matrix metalloproteinase-23, MIFR, MIFR-1MMP22femalysin, MMP21, MMP-21, MMP-22, MMP-23, MMP23A
MMP23B
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
O75900
8510
Synthetic peptides corresponding to MMP23B(matrix metallopeptidase 23B) The peptide sequence was selected from the middle region of MMP23B. Peptide sequence QKILHKKGKVYWYKDQEPLEFSYPGYLALGEAHLSIIANAVNEGTYTCVV.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit