MNS1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP153041

Catalog No. NBP153041

Description

MNS1 Polyclonal specifically detects MNS1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MNS1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8NEH6
• Gene Symbols: MNS1
• Immunogen: Synthetic peptides corresponding to MNS1(meiosis-specific nuclear structural 1) The peptide sequence was selected from the middle region of MNS1. Peptide sequence KVQENEEKRLQLQNALTQKLEEMLRQREDLEQVRQELYQEEQAEIYKSKL.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55329
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ11222FLJ26051, meiosis-specific nuclear structural 1, meiosis-specific nuclear structural protein 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 60 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.