Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MNS1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | MNS1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP153041
|
Novus Biologicals
NBP153041 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
MNS1 Polyclonal specifically detects MNS1 in Human samples. It is validated for Western Blot.Specifications
| MNS1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| FLJ11222FLJ26051, meiosis-specific nuclear structural 1, meiosis-specific nuclear structural protein 1 | |
| MNS1 | |
| IgG | |
| Affinity Purified | |
| 60 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8NEH6 | |
| 55329 | |
| Synthetic peptides corresponding to MNS1(meiosis-specific nuclear structural 1) The peptide sequence was selected from the middle region of MNS1. Peptide sequence KVQENEEKRLQLQNALTQKLEEMLRQREDLEQVRQELYQEEQAEIYKSKL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title