Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ MOBKL1B Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Manufacturer:  Novus Biologicals™ NBP257643PEP

Catalog No. NBP257643PE


Add to cart

Description

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MOBKL1B. Source: E.coli Amino Acid Sequence: RSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNL The MOBKL1B Recombinant Protein Antigen is derived from E. coli. The MOBKL1B Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifications

Specifications

Blocking/Neutralizing, Control
55233
>80% by SDS-PAGE and Coomassie blue staining
E.coli
RUO
MOB1A
Unlabeled
Yes
PBS and 1M Urea, pH 7.4
MOBKL1B Recombinant Protein Antigen
100μL
Store at −20°C. Avoid freeze-thaw cycles
C2orf6, chromosome 2 open reading frame 6, FLJ10788, FLJ11595, MATS1, MOB1, Mob1 alpha, Mob1 homolog 1B, MOB1, Mps One Binder kinase activator-like 1B (yeast), mob1A, Mob4B, MOBK1B, mps one binder kinase activator-like 1B, Protein Mob4B
Recombinant Protein Antigen
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For research use only.