Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MOBKL2A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | MOBKL2A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP168979
|
Novus Biologicals
NBP168979 |
100 μL |
Each for $436.00
|
|
NBP16897920
|
Novus Biologicals
NBP16897920UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
MOBKL2A Polyclonal specifically detects MOBKL2A in Human samples. It is validated for Western Blot.Specifications
| MOBKL2A | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| MOB LAK, Mob1 homolog 2A, MOB1, Mps One Binder kinase activator-like 2A (yeast), MOB3A, moblak, MOB-LAKmps one binder kinase activator-like 2A, Protein Mob3A | |
| MOB3A | |
| IgG | |
| Affinity Purified | |
| 25 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q96BX8 | |
| 126308 | |
| Synthetic peptides corresponding to MOBKL2A (MOB1, Mps One Binder kinase activator-like 2A (yeast)) The peptide sequence was selected from the middle region of MOBKL2A. Peptide sequence EYRWQDEHKFRKPTALSAPRYMDLLMDWIEAQINNEDLFPTNVGTPFPKN. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title