Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Mohawk homeobox Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP31094825UL

 View more versions of this product

Catalog No. NB126796


Add to cart

Description

Description

Mohawk homeobox Polyclonal specifically detects Mohawk homeobox in Human samples. It is validated for Western Blot, Immunohistochemistry.
Specifications

Specifications

Mohawk homeobox
Unconjugated
PBS buffer, 2% sucrose
C10orf48, homeobox protein Mohawk, IFRX, Iroquois family related homeodomain protein, iroquois homeobox protein-like 1, IRXL1chromosome 10 open reading frame 48, MGC39616, mohawk homeobox
The immunogen is a synthetic peptide directed towards the middle region of human Mohawk homeobox (NP_775847). Peptide sequence IKSENSVIKAGVRPESRASEDYVAPPKYKSSLLNRYLNDSLRHVMATNTT
25 μg
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot, Immunohistochemistry
Western Blot 1.0 ug/ml, Immunohistochemistry
Purified
Rabbit
Affinity purified
RUO
Primary
283078
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit